General Information

  • ID:  hor006049
  • Uniprot ID:  Q6ECK6
  • Protein name:  Endokinin-2
  • Gene name:  TAC4
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:1902093 positive regulation of flagellated sperm motility
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  VRGYQMGQRGLL
  • Length:  12(71-82)
  • Propeptide:  MPSSVTLLLLMGLSVCTSAEDGGEEQTLGAEAGPWVTVTLEAGAVASIQLQLQEVKRGKASQFFGLMGKRVRGYQMGQRGLLGRRASSTKGSVDEDQGAE
  • Signal peptide:  MPSSVTLLLLMGLSVCTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  TACR1, TACR2
  • Target Unid:   G1SEI7, P79218
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6ECK6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006049_AF2.pdbhor006049_ESM.pdb

Physical Information

Mass: 157402 Formula: C59H100N20O16S
Absent amino acids: ACDEFHIKNPSTW Common amino acids: G
pI: 11.15 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -40 Boman Index: -2201
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 89.17
Instability Index: -1205.83 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  NA
  • Title:  NA